PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.21G20
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 443aa    MW: 49406.4 Da    PI: 4.7233
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.21G20genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.57.2e-34168222155
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  k+r+rWtpeLHe+Fveav+qLGGsekAtPk +l+lm v+gLt++hvkSHLQkYR+
  Araip.21G20 168 KQRMRWTPELHEAFVEAVNQLGGSEKATPKGVLNLMRVEGLTIYHVKSHLQKYRT 222
                  79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.188165225IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-31166224IPR009057Homeodomain-like
SuperFamilySSF466891.0E-17166222IPR009057Homeodomain-like
TIGRFAMsTIGR015575.8E-25168222IPR006447Myb domain, plants
PfamPF002499.3E-10170221IPR001005SANT/Myb domain
PfamPF143791.7E-20256298IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 443 aa     Download sequence    Send to blast
MSSSFPVLPT SAAQASSINS NIRSVGHMFS TPADFPDDGV PFPTASEIHS TTQASQPLRQ  60
IDDVSWGADL FDNILLFPDN NNAPFQNDHT VYSAPYTSSD NPKAVDFEWV DPFMSDDDPL  120
QLNWNQFVSD TNVAEPKPKE SQLSIQQQVP PVEANGLPDS VSTAPQTKQR MRWTPELHEA  180
FVEAVNQLGG SEKATPKGVL NLMRVEGLTI YHVKSHLQKY RTARYKPEPS EGAPEKKLTD  240
SIEEMKPLDL KTSKGITEAL RLQMELQKRL HEQLEIQRKL QIQIEDQGKR LQMMFEKQIE  300
GSSSAPLSST GLHTNENSEP QNDDNDKQEP GDEQLIAPPP KRCSFSLDKE DEGVSVTSLL  360
FFLQSSSVRL VSGQEEDEVL LESSPLCTYL SLEKKKKNPV PPRPPCQFSV PSRPPCVRTQ  420
QPVGGILAGC QSLYRQEPRP FLL
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN2015271e-116JN201527.1 Glycine max PHR2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016176638.10.0PREDICTED: protein PHR1-LIKE 1-like
TrEMBLG7I6T31e-127G7I6T3_MEDTR; Myb-like transcription factor family protein
STRINGGLYMA19G43690.21e-122(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15123498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.11e-76phosphate starvation response 1